PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D09G0453
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 254aa    MW: 28839.5 Da    PI: 6.4162
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D09G0453genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.4e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv+ +  +G  +W++ ++  g++R++k+c++rw +yl
      Gh_D09G0453 14 KGPWTAEEDRKLVNFIVTHGQCCWRSLPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.11.5e-1671111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
      Gh_D09G0453  71 NQDEEQLVIDLHARLGNR-WSKIAARFP-GRTDNEIKNHWNTH 111
                      589***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-21562IPR009057Homeodomain-like
PROSITE profilePS5129414.841961IPR017930Myb domain
SuperFamilySSF466892.9E-2711108IPR009057Homeodomain-like
SMARTSM007173.2E-131363IPR001005SANT/Myb domain
PfamPF002492.3E-141461IPR001005SANT/Myb domain
CDDcd001676.50E-101661No hitNo description
PROSITE profilePS5129426.57262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2463117IPR009057Homeodomain-like
SMARTSM007171.3E-1466114IPR001005SANT/Myb domain
CDDcd001673.79E-1171112No hitNo description
PfamPF002491.2E-1472111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDRKLVNFIV THGQCCWRSL PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL NQDEEQLVID LHARLGNRWS KIAARFPGRT DNEIKNHWNT HIKKKLIKMG  120
IDPVTHEPLQ KPDTQHEPSY SHGANDYHPN LDKNQLELPK ICANVSSTAA DVLRTSSETG  180
SDEDPLMNLI WSDAFPNDLS WNLTGLDSWE ECSEVELFSS ELLENGNAID GYHSFGFGGF  240
TEIDFNSLDM GAKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012484335.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX62e-86ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0D2RR780.0A0A0D2RR78_G
STRINGPOPTR_0015s14600.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.12e-85myb domain protein 42